PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G248300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 358aa    MW: 39221.8 Da    PI: 5.7772
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G248300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-1869116148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+WT +Ed+ l+++++++G g+W++ ar  g++Rt+k+c++rw++yl
  Sevir.8G248300.1.p  69 RGPWTVDEDLTLINYIAEHGEGRWNALARAAGLKRTGKSCRLRWLNYL 116
                         89********************************************97 PP

2Myb_DNA-binding50.93.5e-16122165146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg +T++E++l++d++ ++G++ W++Ia+ ++ gRt++++k++w++
  Sevir.8G248300.1.p 122 RGDFTADEQLLILDLHSRWGNR-WSKIAAQLP-GRTDNEIKNYWRT 165
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7564116IPR017930Myb domain
SuperFamilySSF466893.74E-3067163IPR009057Homeodomain-like
SMARTSM007172.3E-1568118IPR001005SANT/Myb domain
PfamPF002491.5E-1669116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2270123IPR009057Homeodomain-like
CDDcd001674.28E-1171116No hitNo description
PROSITE profilePS5129423.021117171IPR017930Myb domain
SMARTSM007171.9E-14121169IPR001005SANT/Myb domain
PfamPF002498.9E-15122165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-23124170IPR009057Homeodomain-like
CDDcd001673.53E-10125165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MEMVLQPQRA AGISGGCRPG PPRPAAAATA ATAAMMAMPR AKREHEEMME AADGAAAEVE  60
VEAEAELRRG PWTVDEDLTL INYIAEHGEG RWNALARAAG LKRTGKSCRL RWLNYLRPDV  120
KRGDFTADEQ LLILDLHSRW GNRWSKIAAQ LPGRTDNEIK NYWRTRVQKH AKQLNCDVNS  180
ARFKDAMRFL WMPRLAERAA AAQHQHHQQA AAAIVSGGAA VSTTLITVPE VMTMMMNNEN  240
DDDRSPCSAV TTATTTSSSS SHTSSESTAR DAVPVGGGGG DDEWAAMQQQ DQEFWSTASA  300
LQQLTAAGSG DHHHQLFQFQ ADLPLQDLTG WVQGFSDGVS PETTTQLWSL DDIWRMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-256616924126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7284141e-174KJ728414.1 Zea mays clone pUT6719 MYB transcription factor (MYB4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979993.10.0PREDICTED: transcription factor MYB108
TrEMBLK3ZJ210.0K3ZJ21_SETIT; Uncharacterized protein
STRINGSi026574m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.13e-74myb domain protein 112